PDB entry 4d01

View 4d01 on RCSB PDB site
Description: Crystal Structure of the Extracellular Domain of the Human Alpha9 Nicotinic Acetylcholine Receptor
Class: signaling protein
Keywords: signaling protein, ligand binding domain, cys-loop receptor
Deposited on 2014-04-23, released 2014-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal acetylcholine receptor subunit alpha-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGM1 (Start-211)
      • expression tag (212-214)
    Domains in SCOPe 2.06: d4d01a1, d4d01a2
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d01A (A:)
    adgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirq
    iwhdayltwdrdqydgldsiripsdlvwrpdivlynkaddessepvntnvvlrydglitw
    dapaitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewev
    hgmpavknvisygccsepypdvtftlllkrrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d01A (A:)
    dgkyaqklfndlfedysnalrpvedtdkvlnvtlqitlsqikdmdernqiltaylwirqi
    whdayltwdrdqydgldsiripsdlvwrpdivlynkaddeepvntnvvlrydglitwdap
    aitksscvvdvtyfpfdnqqcnltfgswtyngnqvdifnaldsgdlsdfiedvewevhgm
    pavknvisygccsepypdvtftlllkrrshhh