PDB entry 4cz7

View 4cz7 on RCSB PDB site
Description: Truncated tetramerization domain of zebrafish p53 (crystal form III)
Class: cell cycle
Keywords: cell cycle, tumor suppressor, transcription factor protein evolution, danio rerio
Deposited on 2014-04-16, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.14415
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cz7a_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-32)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d4cz7b_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-32)
      • expression tag (2)
    Domains in SCOPe 2.05: d4cz7c_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-32)
      • expression tag (2)
    Domains in SCOPe 2.05: d4cz7d_
  • Chain 'E':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.05: d4cz7e_
  • Chain 'F':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-32)
      • expression tag (2)
    Domains in SCOPe 2.05: d4cz7f_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cz7A (A:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7A (A:)
    eeiftlqvrgreryeilkklndslelsdvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cz7B (B:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7B (B:)
    gseeiftlqvrgreryeilkklndslelsdvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cz7C (C:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7C (C:)
    seeiftlqvrgreryeilkklndslelsdvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cz7D (D:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7D (D:)
    seeiftlqvrgreryeilkklndslelsdvv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cz7E (E:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7E (E:)
    gseeiftlqvrgreryeilkklndslelsd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cz7F (F:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz7F (F:)
    seeiftlqvrgreryeilkklndslelsdvv