PDB entry 4cz6

View 4cz6 on RCSB PDB site
Description: Truncated tetramerization domain of zebrafish p53 (crystal form II)
Class: antitumor protein
Keywords: antitumor protein, p53 family, tumor suppressor, transcription factor, protein evolution
Deposited on 2014-04-16, released 2014-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79734 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.08: d4cz6a1, d4cz6a2
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cz6b_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cz6c_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79734 (3-32)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d4cz6d1, d4cz6d2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cz6A (A:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz6A (A:)
    seeiftlqvrgreryeilkklndslelsdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cz6B (B:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz6B (B:)
    eiftlqvrgreryeilkklndslelsdvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cz6C (C:)
    ggseeiftlqvrgreryeilkklndslelsdvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz6C (C:)
    eiftlqvrgreryeilkklndslelsdv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cz6D (D:)
    ggseeiftlqvrgreryeilkklndslelsdvv