PDB entry 4cz2

View 4cz2 on RCSB PDB site
Description: Complex of human VARP-ANKRD1 with Rab32-GppCp. Selenomet derivative.
Class: signaling protein
Keywords: signaling protein, varp, rab-effector, rab, endosome, vesicle trafficking, melanosome biogenesis
Deposited on 2014-04-16, released 2014-06-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.1968
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13637
      • engineered mutation (89)
      • engineered mutation (104)
      • engineered mutation (157)
      • engineered mutation (162)
      • engineered mutation (196)
    Domains in SCOPe 2.06: d4cz2a_
  • Chain 'B':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13637
      • engineered mutation (89)
      • engineered mutation (104)
      • engineered mutation (157)
      • engineered mutation (162)
      • engineered mutation (196)
    Domains in SCOPe 2.06: d4cz2b_
  • Chain 'C':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13637
      • engineered mutation (89)
      • engineered mutation (104)
      • engineered mutation (157)
      • engineered mutation (162)
      • engineered mutation (196)
    Domains in SCOPe 2.06: d4cz2c_
  • Chain 'D':
    Compound: ankyrin repeat domain-containing protein 27
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ankyrin repeat domain-containing protein 27
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ankyrin repeat domain-containing protein 27
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GCP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cz2A (A:)
    gplgsmagggagdpglgaaaapapetrehlfkvlvigelgvgktsiikryvhqlfsqhyr
    atigvdfalkvlnwdsrtlvrlqlwdiaglerfgnmtrvyykeamgafvvfdisrsstfe
    avlkwksdldskvhlpngspipavllankcdqnkdssmspsqmdqfckehgfagwfetsa
    kdninieeaarflvekmlvnhqsfpneendvdkikldqetlraenksqcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz2A (A:)
    rehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlqlwd
    iaglerfgnmtrvyykeamgafvvfdisrsstfeavlkwksdldskvhlpngspipavll
    ankcdqnmspsqmdqfckehgfagwfetsakdninieeaarflvekmlvnhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cz2B (B:)
    gplgsmagggagdpglgaaaapapetrehlfkvlvigelgvgktsiikryvhqlfsqhyr
    atigvdfalkvlnwdsrtlvrlqlwdiaglerfgnmtrvyykeamgafvvfdisrsstfe
    avlkwksdldskvhlpngspipavllankcdqnkdssmspsqmdqfckehgfagwfetsa
    kdninieeaarflvekmlvnhqsfpneendvdkikldqetlraenksqcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz2B (B:)
    trehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlqlw
    diaglerfgnmtrvyykeamgafvvfdisrsstfeavlkwksdldskvhlpngspipavl
    lankcdqnkdssmspsqmdqfckehgfagwfetsakdninieeaarflvekmlvnhqsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cz2C (C:)
    gplgsmagggagdpglgaaaapapetrehlfkvlvigelgvgktsiikryvhqlfsqhyr
    atigvdfalkvlnwdsrtlvrlqlwdiaglerfgnmtrvyykeamgafvvfdisrsstfe
    avlkwksdldskvhlpngspipavllankcdqnkdssmspsqmdqfckehgfagwfetsa
    kdninieeaarflvekmlvnhqsfpneendvdkikldqetlraenksqcc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cz2C (C:)
    rehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlqlwd
    iaglerfgnmtrvyykeamgafvvfdisrsstfeavlkwksdldskvhlpngspipavll
    ankcdqnmspsqmdqfckehgfagwfetsakdninieeaarflvekmlvnhqs
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.