PDB entry 4cya

View 4cya on RCSB PDB site
Description: DpsA15 from Streptomyces coelicolor
Class: iron binding protein
Keywords: iron binding protein, dps, ferritin
Deposited on 2014-04-10, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.16036
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dpsa15
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cyaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4cyaA (A:)
dltpkytvpgiereaagrligvlrlrlhalndlhltlkhvhwnvvgphfiavhemidpqv
dqvrdmaddvaeriaalggvaqgtpgalvaerkwddysigradaiahlgaldvvytgvve
gmraaveeagkidpatedlligqlrdleqfqwfvrahles