PDB entry 4cxq

View 4cxq on RCSB PDB site
Description: Mycobaterium tuberculosis transaminase BioA complexed with substrate KAPA
Class: transferase
Keywords: transferase, transaminase, tuberculosis
Deposited on 2014-04-08, released 2014-04-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1569
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cxqa_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cxqb_
  • Heterogens: PLP, KAP, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cxqA (A:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxqA (A:)
    ltpeqiiavdgahlwhpyssigrevspvvavaahgawltlirdgqpievldamsswwtai
    hghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvsv
    evaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfa
    pqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrrye
    vllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisag
    aagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdv
    rvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamve
    varlvgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cxqB (B:)
    mgsshhhhhhssglvprgshmaaatggltpeqiiavdgahlwhpyssigreavspvvava
    ahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthepa
    arlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgd
    tflamsicdphggmhslwtdvlaaqvfapqvprdydpaysaafeaqlaqhagelaavvve
    pvvqgaggmrfhdprylhdlrdicrryevllifdeiatgfgrtgalfaadhagvspdimc
    vgkaltggylslaatlctadvahtisagaagalmhgptfmanplacavsvasvelllgqd
    wrtritelaagltagldtaralpavtdvrvcgaigviecdrpvdlavatpaaldrgvwlr
    pfrnlvyamppyictpaeitqitsamvevarlvgslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxqB (B:)
    ltpeqiiavdgahlwhpyssigrespvvavaahgawltlirdgqpievldamsswwtaih
    ghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvsve
    vaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfap
    qvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrryev
    llifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisaga
    agalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtdvr
    vcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvev
    arlvgs