PDB entry 4cx9

View 4cx9 on RCSB PDB site
Description: The 5-coordinate proximal NO complex of cytochrome c prime from Shewanella frigidimarina
Class: electron transport
Keywords: electron transport, nitrosyl, proximal, gas sensor
Deposited on 2014-04-04, released 2015-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c, class II
    Species: Shewanella frigidimarina [TaxId:56812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cx9a_
  • Chain 'B':
    Compound: cytochrome c, class II
    Species: Shewanella frigidimarina [TaxId:56812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cx9b_
  • Heterogens: NO, HEC, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4cx9A (A:)
nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi
agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg
chdvykkd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4cx9B (B:)
nfeepadaieyrqaafgliaynfgdmgamlkgkkpfdaavfstradnvaalskiphegfi
agsdkgdtealakiwqdkadfdskmtafqdnaaalavaakssdqnnikqafantgksckg
chdvykkd