PDB entry 4cx7

View 4cx7 on RCSB PDB site
Description: Structure of human iNOS heme domain in complex with (R)-6-(3-AMINO-2-(5-(2-(6-AMINO-4- METHYLPYRIDIN-2-YL)ETHYL)PYRIDIN-3-YL)PROPYL)-4- METHYLPYRIDIN-2-AMINE
Class: oxidoreductase
Keywords: oxidoreductase, inhibitor complex
Deposited on 2014-04-03, released 2014-08-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.17571
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cx7a_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cx7b_
  • Chain 'C':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cx7c_
  • Chain 'D':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cx7d_
  • Heterogens: HEM, H4B, S71, GOL, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cx7A (A:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cx7A (A:)
    rhvriknwgsgmtfqdtlhhkakgiclgsimtpksltrgprdkptppdellpqaiefvnq
    yygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcigriqwsnl
    qvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwnaqliryag
    yqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeippdlvlev
    amehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrdfcdvqry
    nileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaesfmkymqn
    eyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cx7B (B:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cx7B (B:)
    rhvriknwgsgmtfqdtlhhkakgiclgsimtpksltrgprdkptppdellpqaiefvnq
    yygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcigriqwsnl
    qvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwnaqliryag
    yqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeippdlvlev
    amehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrdfcdvqry
    nileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaesfmkymqn
    eyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cx7C (C:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cx7C (C:)
    rhvriknwgsgmtfqdtlhhkakgiclgsimtpksltrgprdkptppdellpqaiefvnq
    yygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcigriqwsnl
    qvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwnaqliryag
    yqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeippdlvlev
    amehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrdfcdvqry
    nileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaesfmkymqn
    eyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cx7D (D:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cx7D (D:)
    rhvriknwgsgmtfqdtlhhkakgiclgsimtpksltrgprdkptppdellpqaiefvnq
    yygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcigriqwsnl
    qvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwnaqliryag
    yqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeippdlvlev
    amehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrdfcdvqry
    nileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaesfmkymqn
    eyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwqd