PDB entry 4cvr

View 4cvr on RCSB PDB site
Description: Structure of Apobacterioferritin Y25F variant
Class: oxidoreductase
Keywords: oxidoreductase, electron transfer
Deposited on 2014-03-29, released 2014-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13534
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABD3 (1-End)
      • engineered mutation (25)
      • engineered mutation (46)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d4cvra_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cvrA (A:)
    amkgdtkvinylnkllgnelvainqfflharmfknwglkrlndveyresidemkhadryi
    erilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdm
    mieilrdeeghidwleteldliqkmglqnylqaqireeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvrA (A:)
    mkgdtkvinylnkllgnelvainqfflharmfknwglkrlndveyresidemkhadryie
    rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm
    ieilrdeeghidwleteldliqkmglqnylqaqire