PDB entry 4cvq

View 4cvq on RCSB PDB site
Description: crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution
Class: transferase
Keywords: transferase, amino acid metabolism
Deposited on 2014-03-28, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate-pyruvate aminotransferase alaa
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cvqa_
  • Chain 'B':
    Compound: glutamate-pyruvate aminotransferase alaa
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cvqb_
  • Heterogens: PLP, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cvqA (A:)
    mkhhhhhhpmsdydipttenlyfegamspiekssklenvcydirgpvlkeakrleeegnk
    vlklnignpapfgfdapdeilvdvirnlptaqgycdskglysarkaimqhyqargmrdvt
    vediyigngvselivqamqallnsgdemlvpapdyplwtaavslssgkavhylcdessdw
    fpdlddirakitprtrgiviinpnnptgavyskellmeiveiarqhnliifadeiydkil
    yddaehhsiaplapdlltitfnglsktyrvagfrqgwmvlngpkkhakgyieglemlasm
    rlcanvpaqhaiqtalggyqsisefitpggrlyeqrnrawelindipgvscvkprgalym
    fpkidakrfnihddqkmvldfllqekvllvqgtafnwpwpdhfrivtlprvddielslsk
    farflsgyhql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvqA (A:)
    mspiekssklenvcydirgpvlkeakrleeegnkvlklnignpapfgfdapdeilvdvir
    nlptaqgycdskglysarkaimqhyqargmrdvtvediyigngvselivqamqallnsgd
    emlvpapdyplwtaavslssgkavhylcdessdwfpdlddirakitprtrgiviinpnnp
    tgavyskellmeiveiarqhnliifadeiydkilyddaehhsiaplapdlltitfnglsk
    tyrvagfrqgwmvlngpkkhakgyieglemlasmrlcanvpaqhaiqtalggyqsisefi
    tpggrlyeqrnrawelindipgvscvkprgalymfpkidakrfnihddqkmvldfllqek
    vllvqgtafnwpwpdhfrivtlprvddielslskfarflsgyhq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cvqB (B:)
    mkhhhhhhpmsdydipttenlyfegamspiekssklenvcydirgpvlkeakrleeegnk
    vlklnignpapfgfdapdeilvdvirnlptaqgycdskglysarkaimqhyqargmrdvt
    vediyigngvselivqamqallnsgdemlvpapdyplwtaavslssgkavhylcdessdw
    fpdlddirakitprtrgiviinpnnptgavyskellmeiveiarqhnliifadeiydkil
    yddaehhsiaplapdlltitfnglsktyrvagfrqgwmvlngpkkhakgyieglemlasm
    rlcanvpaqhaiqtalggyqsisefitpggrlyeqrnrawelindipgvscvkprgalym
    fpkidakrfnihddqkmvldfllqekvllvqgtafnwpwpdhfrivtlprvddielslsk
    farflsgyhql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvqB (B:)
    spiekssklenvcydirgpvlkeakrleeegnkvlklnignpapfgfdapdeilvdvirn
    lptaqgycdskglysarkaimqhyqargmrdvtvediyigngvselivqamqallnsgde
    mlvpapdyplwtaavslssgkavhylcdessdwfpdlddirakitprtrgiviinpnnpt
    gavyskellmeiveiarqhnliifadeiydkilyddaehhsiaplapdlltitfnglskt
    yrvagfrqgwmvlngpkkhakgyieglemlasmrlcanvpaqhaiqtalggyqsisefit
    pggrlyeqrnrawelindipgvscvkprgalymfpkidakrfnihddqkmvldfllqekv
    llvqgtafnwpwpdhfrivtlprvddielslskfarflsgyhql