PDB entry 4cvl

View 4cvl on RCSB PDB site
Description: PaMurF in complex with AMP-PNP
Class: ligase
Keywords: ligase, murf,
Deposited on 2014-03-28, released 2015-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HVZ7 (0-End)
      • conflict (38)
      • conflict (427)
    Domains in SCOPe 2.07: d4cvla1, d4cvla2, d4cvla3
  • Heterogens: ACP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cvlA (A:)
    mleplrlsqltvaldarligedavfsavstdsraigpgelfialsgprfdghdylaevaa
    kgavaalverevadaplpqllvrdtraalgrlgalnrrkftgplaamtgssgkttvkeml
    asilrtqagdaesvlatrgnlnndlgvpltllqlapqhrsavielgasrigeiaytvelt
    rphvaiitnagtahvgefggpekiveakgeileglaadgtavlnlddkafdtwkarasgr
    plltfsldrpqadfraadlqrdargcmgfrlqgvageaqvqlnllgrhnvanalaaaaaa
    halgvpldgivaglqalqpvkgravaqltasglrviddsynanpasmlaaidilsgfsgr
    tvlvlgdmgelgswaeqahrevgayaagkvsalyavgplmahavqafgatgrhfadqasl
    igalatedptttilikgsrsaamdkvvaalcgsseeshssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvlA (A:)
    mleplrlsqltvaldarligedavfsavstdsraigpgelfialsdghdylaevaakgav
    aalvereaplpqllvrdtraalgrlgalnrrkftgplaamtgssgkttvkemlasilrtq
    agdaesvlatrgnlnndlgvpltllqlapqhrsavielgasrigeiaytveltrphvaii
    tnagpekiveakgeileglaadgtavlnlddkafdtwkarasgrplltfsldrpqadfra
    adlqrdargcmgfrlqgvageaqvqlnllgrhnvanalaaaaaahalgvpldgivaglqa
    lqpvkgravaqltasglrviddspasmlaaidilsgfsgrtvlvlgdmgaeqahrevgay
    aagkvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsrsaamdk
    vvaalc