PDB entry 4cvc

View 4cvc on RCSB PDB site
Description: Crystal structure of quinone-dependent alcohol dehydrogenase from Pseudogluconobacter saccharoketogenenes with zinc in the active site
Class: oxidoreductase
Keywords: oxidoreductase, carbohydrate oxidation, quinoprotein
Deposited on 2014-03-25, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: PSEUDOGLUCONOBACTER SACCHAROKETOGENES [TaxId:133921]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cvca_
  • Heterogens: PEG, PQQ, ZN, CL, PPI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cvcA (A:)
    aepskagqsaienfqpvtaddlagknpanwpilrgnyqgwgyspldqinkdnvgdlqlvw
    srtmepgsnegaaiayngviflgntndviqaidgktgsliweyrrklpsaskfinslgaa
    krsialfgdkvyfvswdnfvvaldaktgklawetnrgqgveegvanssgpivvdgvviag
    stcqfsgfgcyvtgtdaesgeelwrntfiprpgeegddtwggapyenrwmtgawgqityd
    peldlvyygstgagpasevqrgteggtlagtntrfavkpktgevvwkhqtlprdnwdsec
    tfemmvvstsvnpdakadgmmsvganvprgetrkvltgvpcktgvawqfdaktgdyfwsk
    atveqnsiasiddtglvtvnedmilkepgktynycptflggrdwpsagylpksnlyvipl
    snacydvmartteatpadvyntdatlvlapgktnmgrvdaidlatgetkwsyetraalyd
    pvlttggdlvfvggidrdfraldaesgkevwstrlpgavsgyttsysidgrqyvavvsgg
    slggptfgpttpdvdsasgangiyvfalpekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cvcA (A:)
    saienfqpvtaddlagknpanwpilrgnyqgwgyspldqinkdnvgdlqlvwsrtmepgs
    negaaiayngviflgntndviqaidgktgsliweyrrklpsaskfinslgaakrsialfg
    dkvyfvswdnfvvaldaktgklawetnrgqgveegvanssgpivvdgvviagstcqfsgf
    gcyvtgtdaesgeelwrntfiprpgeegddtwggapyenrwmtgawgqitydpeldlvyy
    gstgagpasevqrgteggtlagtntrfavkpktgevvwkhqtlprdnwdsectfemmvvs
    tsvnpdakadgmmsvganvprgetrkvltgvpcktgvawqfdaktgdyfwskatveqnsi
    asiddtglvtvnedmilkepgktynycptflggrdwpsagylpksnlyviplsnacydvm
    artteatpadvyntdatlvlapgktnmgrvdaidlatgetkwsyetraalydpvlttggd
    lvfvggidrdfraldaesgkevwstrlpgavsgyttsysidgrqyvavvsggslggptfg
    pttpdvdsasgangiyvfalpe