PDB entry 4cv3

View 4cv3 on RCSB PDB site
Description: Crystal structure of E. coli FabI in complex with NADH and PT166
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase superfamily, fatty acid biosynthesis, lipid synthesis, ecfabi, oxidoreductase
Deposited on 2014-03-22, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17799
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cv3a_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cv3b_
  • Heterogens: VT4, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cv3A (A:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cv3A (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpiceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggfsiaamn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cv3B (B:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cv3B (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpiceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggfsiaamn