PDB entry 4cu8

View 4cu8 on RCSB PDB site
Description: Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, beta-galactosidase
Deposited on 2014-03-17, released 2014-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.16374
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase 2
    Species: Streptococcus pneumoniae TIGR4 [TaxId:170187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cu8a1, d4cu8a2, d4cu8a3, d4cu8a4, d4cu8a5
  • Heterogens: DGJ, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cu8A (A:)
    avtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdh
    espaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngy
    nqfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtdkvhvekngtti
    ltpkleeqqhgkvethvtskivntddkdhelvaeyqivergghavtglvrtasrtlkahe
    stsldaileverpklwtvlndkpalyelitrvyrdgqlvdakkdlfgyryyhwtpnegfs
    lngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthnpaseqtlqiaa
    elgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrtmvergknnpai
    fmwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgngsgghekiade
    ldavgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkhsngpernyeqs
    dygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnqtpvkssyfgiv
    dtagipkhdfylyqsqwvsvkkkpmvhllphwnwenkelaskvadsegkipvraysnass
    velflngkslglktfnkkqtsdgrtyqegananelylewkvayqpgtleaiardesgkei
    ardkittagkpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqg
    qlvgvdngeqasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqv
    tvftgkkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cu8A (A:)
    avtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdh
    espaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngy
    nqfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtdkvhvekngtti
    ltpkleeqqhgkvethvtskivntddkdhelvaeyqivergghavtglvrtasrtlkahe
    stsldaileverpklwtvlndkpalyelitrvyrdgqlvdakkdlfgyryyhwtpnegfs
    lngerikfhgvslhhdhgalgaeenykaeyrrlkqmkemgvnsirtthnpaseqtlqiaa
    elgllvqeeafdtwyggkkpydygrffekdathpearkgekwsdfdlrtmvergknnpai
    fmwsigneigeangdahslatvkrlvkvikdvdktryvtmgadkfrfgngsgghekiade
    ldavgfnysednykalrakhpkwliygsetssatrtrgsyyrperelkhsngpernyeqs
    dygndrvgwgktataswtfdrdnagyagqfiwtgtdyigeptpwhnqnqtpvkssyfgiv
    dtagipkhdfylyqsqwvsvkkkpmvhllphwnwenkelaskvadsegkipvraysnass
    velflngkslglktfnkkqtsdgrtyqegananelylewkvayqpgtleaiardesgkei
    ardkittagkpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqg
    qlvgvdngeqasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqv
    tvftgkke