PDB entry 4cts

View 4cts on RCSB PDB site
Description: crystal structure analysis and molecular model of a complex of citrate synthase with oxaloacetate and s-acetonyl-coenzyme a
Class: oxo-acid-lyase
Keywords: oxo-acid-lyase
Deposited on 1984-01-27, released 1984-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ctsa_
  • Chain 'B':
    Compound: citrate synthase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ctsb_
  • Heterogens: OAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ctsA (A:)
    asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
    klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstdgliklvdsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ctsB (B:)
    asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
    degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
    klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
    lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstdgliklvdsk