PDB entry 4cte

View 4cte on RCSB PDB site
Description: Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase familly gh16, marine bacterial enzyme, thio-oligosaccharide complex
Deposited on 2014-03-13, released 2015-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17946
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: Zobellia galactanivorans [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L2L9
      • engineered mutation (119)
    Domains in SCOPe 2.06: d4ctea_
  • Chain 'B':
    Compound: endo-1,3-beta-glucanase, family gh16
    Species: Zobellia galactanivorans [TaxId:63186]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L2L9
      • engineered mutation (119)
    Domains in SCOPe 2.06: d4cteb_
  • Heterogens: CA, CL, EDO, GOL, GS1, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cteA (A:)
    qdynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfg
    gaqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidims
    rinnalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnev
    disngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cteA (A:)
    dynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfgg
    aqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidimsr
    innalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnevd
    isngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cteB (B:)
    qdynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfg
    gaqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidims
    rinnalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnev
    disngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cteB (B:)
    dynlvwqdefddgigpdwvfetgmgyngwgnnelqyyrrenaavengnlvitakhenfgg
    aqytsarmktqgrksfkygkiearialpsgqglwpafwmlgnnitsvswpacgeidimsr
    innalqthgtihwsdqngdhasygddvgvsdpgqyhiysvewdansikwfvdgqqfnevd
    isngvngtgefqneffillnmavggdwpgfdvdqsklpaqmlvdyvrvyqk