PDB entry 4ct4

View 4ct4 on RCSB PDB site
Description: CNOT1 MIF4G domain - DDX6 complex
Class: RNA binding protein
Keywords: RNA binding protein, deadenylation, transcription
Deposited on 2014-03-12, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1687
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: probable ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26196 (3-377)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d4ct4b1, d4ct4b2, d4ct4b3
  • Chain 'C':
    Compound: CCR4-NOT transcription complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: probable ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ct4d1, d4ct4d2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ct4B (B:)
    rsmgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgayl
    ipllerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimr
    lddtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknr
    qillysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsr
    lqinqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvct
    dlftrgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksiee
    qlgteikpipsnidksly
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ct4D (D:)
    rsmgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgayl
    ipllerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimr
    lddtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknr
    qillysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsr
    lqinqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvct
    dlftrgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksiee
    qlgteikpipsnidksly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ct4D (D:)
    gnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylipl
    lerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrldd
    tvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqil
    lysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqi
    nqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdli
    diqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksieeqlgteik
    pips