PDB entry 4csp

View 4csp on RCSB PDB site
Description: STRUCTURE OF THE F306C MUTANT OF NITRITE REDUCTASE FROM Achromobacter XYLOSOXIDANS
Class: oxidoreductase
Keywords: oxidoreductase, electron transfer, microbial ATP-generating respiratory dentrification pathway
Deposited on 2014-03-09, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18279
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (304)
    Domains in SCOPe 2.06: d4cspa1, d4cspa2
  • Chain 'F':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (0-334)
      • engineered mutation (304)
    Domains in SCOPe 2.06: d4cspf1, d4cspf2
  • Heterogens: CU, ZN, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cspA (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieacelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cspF (F:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieacelgaaghikvegkwnddlmkqikapapipr