PDB entry 4csm

View 4csm on RCSB PDB site
Description: yeast chorismate mutase + tyr + endooxabicyclic inhibitor
Class: complex (isomerase/peptide)
Keywords: CHORISMATE PYRUVATE MUTASE, ALLOSTERIC PROTEIN, COMPLEX (ISOMERASE-PEPTIDE), TRANSITION STATE ANALOG, COMPLEX (ISOMERASE-PEPTIDE) complex
Deposited on 1997-07-14, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4csma_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4csmb_
  • Heterogens: TYR, TSA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
    veveyllrrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptnesgerritpeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterritpeylvkiykeivipitke
    veveyllrrlee