PDB entry 4crp

View 4crp on RCSB PDB site
Description: Solution structure of a TrkAIg2 domain construct for use in drug discovery
Class: transferase
Keywords: transferase, trkaig2, nmr construct, pain, alzheimers
Deposited on 2014-02-28, released 2015-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04629 (5-106)
      • expression tag (0-1)
      • expression tag (3-4)
      • engineered mutation (8)
      • engineered mutation (90)
    Domains in SCOPe 2.08: d4crpa1, d4crpa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4crpA (A:)
    dddddvsfcasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepa
    anetvrhgclrlnqpthvnngnytllaanpcgqasasimaafmdnpf