PDB entry 4cro

View 4cro on RCSB PDB site
Description: protein-DNA conformational changes in the crystal structure of a lambda cro-operator complex
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1992-01-15, released 1992-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4croa_
  • Chain 'B':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4crob_
  • Chain 'C':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4croc_
  • Chain 'D':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4crod_
  • Chain 'E':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4croe_
  • Chain 'F':
    Compound: protein (lambda cro)
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4crof_
  • Chain 'G':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')
  • Chain 'I':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')
  • Chain 'J':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')
  • Chain 'K':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')
  • Chain 'L':
    Compound: DNA (5'-d(*tp*ap*tp*cp*ap*cp*cp*gp*cp*gp*gp*gp*tp*gp*ap*tp*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4croA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croA (A:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4croB (B:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croB (B:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4croC (C:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croC (C:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4croD (D:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croD (D:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4croE (E:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croE (E:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4croF (F:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4croF (F:)
    qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
    ktta
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.