PDB entry 4crb

View 4crb on RCSB PDB site
Description: Creating novel F1 inhibitors through fragment based lead generation and structure aided drug design
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-02-26, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • engineered mutation (64)
      • engineered mutation (67)
      • engineered mutation (105)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d4crba_
  • Heterogens: GOL, 7P0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4crbA (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav