PDB entry 4cqm

View 4cqm on RCSB PDB site
Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP
Class: oxidoreductase
Keywords: oxidoreductase, kar, ketoacyl reductase, 3-ketoacyl-acp reductase, ke6, hsd8, 17-beta hydroxysteroid dehydrogenase, hsd17b8, 3r-hydroxyacyl-coa dehydrogenase, cbr4, carbobyl reductase type4, nad, nadh, nadp, nadph, hetero tetramer,
Deposited on 2014-02-19, released 2014-09-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.2049
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqma_
  • Chain 'B':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (3-6)
    Domains in SCOPe 2.05: d4cqmb_
  • Chain 'C':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmc_
  • Chain 'D':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmd_
  • Chain 'E':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqme_
  • Chain 'F':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (3-6)
    Domains in SCOPe 2.05: d4cqmf_
  • Chain 'G':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmg_
  • Chain 'H':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmh_
  • Chain 'I':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmi_
  • Chain 'J':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (4-6)
    Domains in SCOPe 2.05: d4cqmj_
  • Chain 'K':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmk_
  • Chain 'L':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqml_
  • Chain 'M':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmm_
  • Chain 'N':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (4-6)
    Domains in SCOPe 2.05: d4cqmn_
  • Chain 'O':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmo_
  • Chain 'P':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqmp_
  • Heterogens: NAP, GOL, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cqmA (A:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmA (A:)
    qnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllpprgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsv
    evtgglfm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cqmB (B:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmB (B:)
    hhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscd
    vakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltck
    aamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvv
    apgfvhehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cqmC (C:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmC (C:)
    kvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvakehd
    vqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtm
    iqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvh
    tkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cqmD (D:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmD (D:)
    sqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsv
    evtgglfm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cqmE (E:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmE (E:)
    sqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsv
    evtgglfm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cqmF (F:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmF (F:)
    hhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscd
    vakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltck
    aamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvv
    apgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqli
    l
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cqmG (G:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmG (G:)
    cavfggsrgigravaqlmarkgyrlaviarnlegakaaagddhlafscdvakehdvqntf
    eelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtmiqqqg
    gsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtkeeh
    lkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4cqmH (H:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmH (H:)
    asqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaaf
    qadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtf
    lvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgi
    rcnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgts
    vevtgglfm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4cqmI (I:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmI (I:)
    qlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllprgnhaaf
    qadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtf
    lvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgi
    rcnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgts
    vevtgglfm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4cqmJ (J:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmJ (J:)
    hhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdv
    akehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltcka
    amrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvva
    pgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4cqmK (K:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmK (K:)
    mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
    hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
    tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
    vhtkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4cqmL (L:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmL (L:)
    qlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqad
    vsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvt
    qaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircn
    svlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvev
    tgglfm
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4cqmM (M:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmM (M:)
    sqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllrgnhaaf
    qadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtf
    lvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgi
    rcnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgts
    vevtgglfm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4cqmN (N:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmN (N:)
    hhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdv
    akehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltcka
    amrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvva
    pgfvhtehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4cqmO (O:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmO (O:)
    mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
    hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
    tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
    vhtdmdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4cqmP (P:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqmP (P:)
    sqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsv
    evtgglfm