PDB entry 4cql

View 4cql on RCSB PDB site
Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD
Class: oxidoreductase
Keywords: oxidoreductase, kar, 3-ketoacyl-acp reductase, hsd8, 17-beta hydroxysteroid dehydrogenase, hsd17b8, 3r- hydroxyacyl-coa dehydrogenase, carbobyl reductase type4, nadh, nadp, nadph, hetero tetramer,
Deposited on 2014-02-19, released 2014-09-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.185
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqla_
  • Chain 'B':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (5-6)
    Domains in SCOPe 2.05: d4cqlb_
  • Chain 'C':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlc_
  • Chain 'D':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqld_
  • Chain 'E':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqle_
  • Chain 'F':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (2-6)
    Domains in SCOPe 2.05: d4cqlf_
  • Chain 'G':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlg_
  • Chain 'H':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlh_
  • Chain 'I':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqli_
  • Chain 'J':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (5-6)
    Domains in SCOPe 2.05: d4cqlj_
  • Chain 'K':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlk_
  • Chain 'L':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqll_
  • Chain 'M':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlm_
  • Chain 'N':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N4T8 (7-243)
      • expression tag (3-6)
    Domains in SCOPe 2.05: d4cqln_
  • Chain 'O':
    Compound: carbonyl reductase family member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlo_
  • Chain 'P':
    Compound: Estradiol 17-beta-dehydrogenase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4cqlp_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cqlA (A:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlA (A:)
    lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgnhaafqad
    vsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvt
    qaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircn
    svlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvev
    tgglfm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cqlB (B:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlB (B:)
    hhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdva
    kehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaa
    mrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvap
    gfvhkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cqlC (C:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlC (C:)
    kvcavfggsrgigravaqlmarkgyrlaviarnleafscdvakehdvqntfeelekhlgr
    vnflvnaaginrdlvrtktedmvsqlhtnllgsmltckaamrtmiqqqggsivnvgsivg
    lkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtkdlkeehlkkniplg
    rfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cqlD (D:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlD (D:)
    qnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpnhaafqa
    dvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflv
    tqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgirc
    nsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsve
    vtgglf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cqlE (E:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlE (E:)
    qnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadvs
    earaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtqa
    aaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircnsv
    lpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtg
    glfm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cqlF (F:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlF (F:)
    hhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagddhlafscdva
    kehdvqntfeelekhlgrvnflvnaaginllvrtktedmvsqlhtnllgsmltckaamrt
    miqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfv
    htdkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cqlG (G:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlG (G:)
    vfggsrgigravaqlmarkaviarnlakaaagdlggfscdvakehdvqntfeelekhlgv
    nflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtmigsivnvgsivglkg
    nsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtdmtkehlkkniplgrfge
    tievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4cqlH (H:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlH (H:)
    qlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllrgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtggl
    fm
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4cqlI (I:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlI (I:)
    qlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgsnha
    afqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkg
    tflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrh
    gircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitg
    tsvevtgglfm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4cqlJ (J:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlJ (J:)
    hhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagddhlafscdvakeh
    dvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrt
    miqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfv
    hteehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4cqlK (K:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlK (K:)
    kvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggafscdvakehdvqn
    tfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamrtmiqg
    sivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtdmkkn
    iplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4cqlL (L:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlL (L:)
    lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadv
    searaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtq
    aaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircns
    vlpgfiatpmtqvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevtgglfm
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4cqlM (M:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlM (M:)
    lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllnhaafqadv
    searaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtflvtq
    aaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgircns
    vlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvevt
    gglfm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4cqlN (N:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlN (N:)
    hhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscd
    vakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltck
    aamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvv
    apgfvhkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4cqlO (O:)
    mhhhhhhmdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlaf
    scdvakehdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsml
    tckaamrtmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirv
    nvvapgfvhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdggl
    qlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlO (O:)
    mdkvcavfggsrgigravaqlmarkglaviarnlegakaaagdlggfscdvakehdvqnt
    feelekhlgrvnflvnaaginrgllvrtktedmvsqlhtnllgsmltckaamrtmiqqqg
    gsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgfvhtkeeh
    lkkniplgrfgetievahavvfllespyitghvlvvdgglqlil
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4cqlP (P:)
    masqlqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllggpgs
    kegpprgnhaafqadvsearaarclleqvqacfsrppsvvvscagitqdefllhmseddw
    dkviavnlkgtflvtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagviglt
    qtaarelgrhgircnsvlpgfiatpmtqkvpqkvvdkitemipmghlgdpedvadvvafl
    asedsgyitgtsvevtgglfm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cqlP (P:)
    lqnrlrsalalvtgagsgigravsvrlagegatvaacdldraaaqetvrllgrgnhaafq
    advsearaarclleqvqacfsrppsvvvscagitqdefllhmseddwdkviavnlkgtfl
    vtqaaaqalvsngcrgsiinissivgkvgnvgqtnyaaskagvigltqtaarelgrhgir
    cnsvlpgfiatpmtqpqkvvdkitemipmghlgdpedvadvvaflasedsgyitgtsvev
    tgglfm