PDB entry 4cq6

View 4cq6 on RCSB PDB site
Description: The crystal structure of the allene oxide cyclase 2 from Arabidopsis thaliana with bound inhibitor - vernolic acid
Class: isomerase
Keywords: isomerase, jasmonates, cyclization, oxylipins
Deposited on 2014-02-11, released 2015-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allene oxide cyclase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cq6a_
  • Chain 'B':
    Compound: allene oxide cyclase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cq6b_
  • Chain 'C':
    Compound: allene oxide cyclase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cq6c_
  • Heterogens: MRD, PO4, T25, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cq6A (A:)
    mrgshhhhhhgspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq6A (A:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cq6B (B:)
    mrgshhhhhhgspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq6B (B:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cq6C (C:)
    mrgshhhhhhgspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cq6C (C:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn