PDB entry 4cph

View 4cph on RCSB PDB site
Description: trans-divalent streptavidin with love-hate ligand 4
Class: biotin binding protein
Keywords: biotin binding protein, avidin, biotin, strain, biotinylated, steric clash, strained, hindered, force, ligand series, affinity
Deposited on 2014-02-06, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.2025
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (10)
      • engineered mutation (14)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d4cpha_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cphb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cphc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (10)
      • engineered mutation (14)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d4cphd_
  • Heterogens: LH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cphA (A:)
    aeagitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cphA (A:)
    gitgtwyaqlgdtfivtagadgaltgtyeaanaesryvltgrydsapatdgsgtalgwtv
    awknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cphB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaaseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cphB (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cphC (C:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaaseeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cphC (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cphD (D:)
    aeagitgtwyaqlgdtfivtagadgaltgtyeaavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cphD (D:)
    gitgtwyaqlgdtfivtagadgaltgtyeaagnaesryvltgrydsapatdgsgtalgwt
    vawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk