PDB entry 4cpa

View 4cpa on RCSB PDB site
Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution
Class: hydrolase (c-terminal peptidase)
Keywords: hydrolase (c-terminal peptidase)
Deposited on 1982-03-24, released 1982-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.06: d4cpaa_
  • Chain 'B':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.06: d4cpab_
  • Chain 'I':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cpai_
  • Chain 'J':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cpaj_
  • Heterogens: ZN, GLY

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cpaA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cpaB (B:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4cpaI (I:)
    zzhadpicnkpckthddcsgawfcqacwnsartcgpyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpaI (I:)
    zhadpicnkpckthddcsgawfcqacwnsartcgpyv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4cpaJ (J:)
    zzhadpicnkpckthddcsgawfcqacwnsartcgpyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cpaJ (J:)
    zhadpicnkpckthddcsgawfcqacwnsartcgpyv