PDB entry 4cp5

View 4cp5 on RCSB PDB site
Description: ndpK in complex with (Rp)-SPMPApp
Class: transferase
Keywords: transferase
Deposited on 2014-01-31, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5a_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5b_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5c_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5d_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5e_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d4cp5f_
  • Heterogens: EOI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cp5A (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5A (A:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cp5B (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5B (B:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cp5C (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5C (C:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cp5D (D:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5D (D:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cp5E (E:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5E (E:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cp5F (F:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cp5F (F:)
    kvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpf
    fgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggs
    dsvesanreialwfkpeelltevkpnpnlye