PDB entry 4coq

View 4coq on RCSB PDB site
Description: The complex of alpha-Carbonic anhydrase from Thermovibrio ammonificans with inhibitor sulfanilamide.
Class: lyase
Keywords: lyase
Deposited on 2014-01-30, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.17723
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonate dehydratase
    Species: Thermovibrio ammonificans [TaxId:648996]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coqa_
  • Chain 'B':
    Compound: Carbonate dehydratase
    Species: Thermovibrio ammonificans [TaxId:648996]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coqb_
  • Heterogens: ZN, SAN, PG6, PG4, PGE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4coqA (A:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coqA (A:)
    gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
    vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
    vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
    segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4coqB (B:)
    mkrvlvtlgavaalatgavagggahwgysgsigpehwgdlspeylmckigknqspidins
    adavkaclapvsvyyvsdakyvvnnghtikvvmggrgyvvvdgkrfylkqfhfhapseht
    vngkhypfeahfvhldkngnitvlgvffkvgkenpelekvwrvmpeepgqkrhltaridp
    ekllpenrdyyrysgslttppcsegvrwivfkepvemsreqlekfrkvmgfdnnrpvqpl
    narkvmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coqB (B:)
    ggahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdaky
    vvnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngni
    tvlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttpp
    csegvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk