PDB entry 4coa

View 4coa on RCSB PDB site
Description: Crystal structure of kynurenine formamidase from Bacillus anthracis complexed with 2-aminoacetophenone.
Class: hydrolase
Keywords: hydrolase, kynb, aerobic tryptophan degradation via anthranilate.
Deposited on 2014-01-28, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.21404
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coaa_
  • Chain 'B':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coab_
  • Chain 'C':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coac_
  • Chain 'D':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4coad_
  • Heterogens: ZN, VNJ, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4coaA (A:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coaA (A:)
    tskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfd
    ndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpd
    iiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvad
    gdyelialplalsdadgspvravirpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4coaB (B:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coaB (B:)
    skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
    dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
    iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
    dyelialplalsdadgspvravirpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4coaC (C:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coaC (C:)
    skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
    dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
    iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
    dyelialplalsdadgspvravirpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4coaD (D:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4coaD (D:)
    skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
    dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
    iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
    dyelialplalsdadgspvravirpi