PDB entry 4co9

View 4co9 on RCSB PDB site
Description: Crystal structure of kynurenine formamidase from Bacillus anthracis
Class: hydrolase
Keywords: hydrolase, aerobic tryptophan degradation via anthranilate.
Deposited on 2014-01-27, released 2014-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4co9a_
  • Chain 'B':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4co9b_
  • Chain 'C':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4co9c_
  • Chain 'D':
    Compound: kynurenine formamidase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4co9d_
  • Heterogens: ZN, MG, DIO, GXT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4co9A (A:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4co9A (A:)
    tskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfd
    ndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpd
    iiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvad
    gdyelialplalsdadgspvravirpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4co9B (B:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4co9B (B:)
    tskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfd
    ndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpd
    iiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvad
    gdyelialplalsdadgspvravirpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4co9C (C:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4co9C (C:)
    skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
    dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
    iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
    dyelialplalsdadgspvravirpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4co9D (D:)
    ghmktskwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidap
    fhfdndgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkan
    efpdiiphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvld
    hvadgdyelialplalsdadgspvravirpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4co9D (D:)
    skwidisqplnndiatwpgdtpfsyevlwskeesgsvnvgkltmsihtgthidapfhfdn
    dgkkvldldiqvyvgptriidvsnlesigkkelekfhlegverlllrtsshgkanefpdi
    iphlradiapflsekgirligvdvpsvdplddkelaahhqlfkhsihilenvvldhvadg
    dyelialplalsdadgspvravirpi