PDB entry 4cnc

View 4cnc on RCSB PDB site
Description: Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
Class: cell adhesion
Keywords: cell adhesion, waif1, tpbg, trovax, cancer, signaling, leucine-rich repeats, wnt/beta-catenin signaling pathway
Deposited on 2014-01-21, released 2014-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.17929
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trophoblast glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cnca_
  • Chain 'B':
    Compound: trophoblast glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cncb_
  • Heterogens: NAG, PEG, GOL, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cncA (A:)
    etgdqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpp
    laelaalnlsgsrldevragafehlpslrqldlshnpladlspfafsgsnasvsapsplv
    elilnhivppederqnrsfegmvvaallagralqglrrlelasnhflylprdvlaqlpsl
    rhldlsnnslvsltyvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpw
    vcdchmadmvtwlketevvqgkdrltcaypekmrnrvllelnsadldcdgtetsqvapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cncA (A:)
    dqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplae
    laalnlsgsrldevragafehlpslrqldlshnpladlspfafssapsplvelilnhivp
    persfegmvvaallagralqglrrlelasnhflylprdvlaqlpslrhldlsnnslvslt
    yvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpwvcdchmadmvtwlk
    etevvqgkdrltcaypekmrnrvllelnsadldc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cncB (B:)
    etgdqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpp
    laelaalnlsgsrldevragafehlpslrqldlshnpladlspfafsgsnasvsapsplv
    elilnhivppederqnrsfegmvvaallagralqglrrlelasnhflylprdvlaqlpsl
    rhldlsnnslvsltyvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpw
    vcdchmadmvtwlketevvqgkdrltcaypekmrnrvllelnsadldcdgtetsqvapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cncB (B:)
    dqcpalcecseaartvkcvnrnltevptdlpayvrnlfltgnqlavlpagafarrpplae
    laalnlsgsrldevragafehlpslrqldlshnpladlspfafsgsnasvsapsplveli
    lnhivppsfegmvvaallagralqglrrlelasnhflylprdvlaqlpslrhldlsnnsl
    vsltyvsfrnlthleslhlednalkvlhngtlaelqglphirvfldnnpwvcdchmadmv
    twlketevvqgkdrltcaypekmrnrvllelnsadldc