SCOPe 2.07: Structural Classification of Proteins

PDB entry 4cmy

View 4cmy on RCSB PDB site
Description: Chlorobium tepidum Ferritin
Class: metal transport
Keywords: metal transport, iron-storage protein, iron metabolism
Deposited on 2014-01-18, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmya_
Chain 'B':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyb_
Chain 'C':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyc_
Chain 'D':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyd_
Chain 'E':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmye_
Chain 'F':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyf_
Chain 'G':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyg_
Chain 'H':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyh_
Chain 'I':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyi_
Chain 'J':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyj_
Chain 'K':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyk_
Chain 'L':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyl_
Chain 'M':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmym_
Chain 'N':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyn_
Chain 'O':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyo_
Chain 'P':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyp_
Chain 'Q':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyq_
Chain 'R':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyr_
Chain 'S':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmys_
Chain 'T':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyt_
Chain 'U':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyu_
Chain 'V':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
  - conflict (144)
Domains in SCOPe 2.07: d4cmyv_
Chain 'W':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyw_
Chain 'X':
Compound: Ferritin
Species: Chlorobaculum tepidum [TaxId:1097]
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KBP5 (0-End)
Domains in SCOPe 2.07: d4cmyx_
Heterogens: FE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4cmyA (A:)
mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
apkhhdghdglhahqhsshwsgh