PDB entry 4cmy

View 4cmy on RCSB PDB site
Description: Chlorobium tepidum Ferritin
Class: metal transport
Keywords: metal transport, iron-storage protein, iron metabolism
Deposited on 2014-01-18, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmya_
  • Chain 'B':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyb_
  • Chain 'C':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyc_
  • Chain 'D':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyd_
  • Chain 'E':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmye_
  • Chain 'F':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyf_
  • Chain 'G':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyg_
  • Chain 'H':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyh_
  • Chain 'I':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyi_
  • Chain 'J':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyj_
  • Chain 'K':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyk_
  • Chain 'L':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyl_
  • Chain 'M':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmym_
  • Chain 'N':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyn_
  • Chain 'O':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyo_
  • Chain 'P':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyp_
  • Chain 'Q':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyq_
  • Chain 'R':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyr_
  • Chain 'S':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmys_
  • Chain 'T':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyt_
  • Chain 'U':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyu_
  • Chain 'V':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KBP5 (0-End)
      • conflict (144)
    Domains in SCOPe 2.07: d4cmyv_
  • Chain 'W':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyw_
  • Chain 'X':
    Compound: Ferritin
    Species: Chlorobaculum tepidum [TaxId:1097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cmyx_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cmyA (A:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyA (A:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cmyB (B:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyB (B:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cmyC (C:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyC (C:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cmyD (D:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyD (D:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cmyE (E:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyE (E:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cmyF (F:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyF (F:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4cmyG (G:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyG (G:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4cmyH (H:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyH (H:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4cmyI (I:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyI (I:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4cmyJ (J:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyJ (J:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4cmyK (K:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyK (K:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4cmyL (L:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyL (L:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4cmyM (M:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyM (M:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4cmyN (N:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyN (N:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4cmyO (O:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyO (O:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4cmyP (P:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyP (P:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4cmyQ (Q:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyQ (Q:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4cmyR (R:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyR (R:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4cmyS (S:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyS (S:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrks
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4cmyT (T:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyT (T:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4cmyU (U:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyU (U:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4cmyV (V:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariidtmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyV (V:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariidtmdgralfrfdeevrksv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4cmyW (W:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyW (W:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4cmyX (X:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksvlhhehhqqkpmflqvgp
    apkhhdghdglhahqhsshwsgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmyX (X:)
    mlsktildklnhqvnfeaasahlylqmsawlltqsldstaaffrahaeeekahmmklfdy
    inetgslaligevatpapewkshielleaaynhelaitqsindlvdtalrekdystfqfl
    qwyvaeqheeeylfssmlhkariintmdgralfrfdeevrksv