PDB entry 4cms

View 4cms on RCSB PDB site
Description: x-ray analyses of aspartic proteinases IV. structure and refinement at 2.2 angstroms resolution of bovine chymosin
Class: hydrolase (acid proteinase)
Keywords: hydrolase (acid proteinase)
Deposited on 1991-11-01, released 1991-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymosin b
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d4cmsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cmsA (A:)
    gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
    rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
    gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
    hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
    nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
    vfireyysvfdrannlvglakai
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cmsA (A:)
    gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
    rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
    gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
    hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
    nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqseqkwilgdvfi
    reyysvfdrannlvglakai