PDB entry 4cla

View 4cla on RCSB PDB site
Description: alternative binding modes for chloramphenicol and 1-substituted chloramphenicol analogues revealed by site-directed mutagenesis and x-ray crystallography of chloramphenicol acetyltransferase
Class: transferase (acyltransferase)
Keywords: transferase (acyltransferase)
Deposited on 1990-10-23, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type III chloramphenicol acetyltransferase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00484 (0-212)
    • conflict (153)
  Domains in SCOPe 2.08: d4claa_
• Heterogens: CO, CLM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4claA (A:)
  mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
  avnqfdelrmaikddelivwdsvdpqftvfhqetetfsalscpyssdidqfmvnylsvme
  ryksdtklfpqgvtpenhlnisalpwvnfdsfnfnvanftdyfapiitmakyqqegdrll
  lplsvqvhhavcdgfhvarfinrlqelcnsklk