PDB entry 4cl7

View 4cl7 on RCSB PDB site
Description: Crystal structure of VEGFR-1 domain 2 in presence of Cobalt
Class: receptor
Keywords: receptor, metal-binding
Deposited on 2014-01-13, released 2015-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1707
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cl7a_
  • Chain 'B':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cl7b_
  • Chain 'C':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cl7c_
  • Chain 'D':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cl7d_
  • Heterogens: CO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cl7A (A:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cl7A (A:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cl7B (B:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cl7B (B:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cl7C (C:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cl7C (C:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cl7D (D:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cl7D (D:)
    rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
    iisnatykeiglltceatvnghlyktnylthrq