PDB entry 4cl0

View 4cl0 on RCSB PDB site
Description: Structure of the Mycobacterium tuberculosis Type II Dehydroquinase inhibited by a 3-dehydroquinic acid derivative
Class: lyase
Keywords: bacterial proteins, type 2 dehydroquinase, lyase, inhibitor, protein binding, shikimis acid pathway, substrate specificity
Deposited on 2014-01-10, released 2015-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4cl0a_
  • Heterogens: 9PY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4cl0A (A:)
selivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlld
wihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspi
atgvivglgiqgyllalrylaehvgt

    Sequence, based on observed residues (ATOM records): (download) 
    >4cl0A (A:)
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylae