PDB entry 4ckv

View 4ckv on RCSB PDB site
Description: Crystal structure of VEGFR-1 domain 2 in presence of Zn
Class: receptor
Keywords: receptor
Deposited on 2014-01-09, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.165
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: vascular endothelial growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ckvx_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ckvX (X:)
    grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
    fiisnatykeiglltceatvnghlyktnylthrq