PDB entry 4cjx

View 4cjx on RCSB PDB site
Description: The crystal structure of Trypanosoma brucei N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor and inhibitor
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-12-23, released 2015-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.18273
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-1-tetrahydrofolate synthase, cytoplasmic, putative
    Species: TRYPANOSOMA BRUCEI BRUCEI STRAIN 927/4 GUTAT10.1 [TaxId:999953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57WP0 (21-End)
      • conflict (100)
    Domains in SCOPe 2.06: d4cjxa1, d4cjxa2
  • Chain 'B':
    Compound: c-1-tetrahydrofolate synthase, cytoplasmic, putative
    Species: TRYPANOSOMA BRUCEI BRUCEI STRAIN 927/4 GUTAT10.1 [TaxId:999953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57WP0 (21-End)
      • conflict (100)
    Domains in SCOPe 2.06: d4cjxb1, d4cjxb2
  • Heterogens: GOL, PEG, 9L9, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cjxA (A:)
    mgsshhhhhhssgenlyfqghmpeavvidgravakaiqkelteevallerrykgrrpgls
    tiicgkrkdsqtyvrlkrkaaaacgfrnfsvelpanvtqealerevirlneeeachsivv
    qlplpphidkvaalskikpekdadcllpvnvgqlhirernpaivpctasavmellrcsgv
    eicgkrvvvlgrgdiaglpvatllanedatvtvvhsatplcdiadivrasdivvsaagqp
    glvrgewiklgaavidvgttpvadpskvpgyrlvgdvcfdvarkraayitpvpggvgpvt
    vsmllkntltmfkrsvral
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cjxA (A:)
    mpeavvidgravakaiqkelteevallerrykgrrpglstiicgkrkdsqtyvrlkrkaa
    aacgfrnfsvelpanvtqealerevirlneeeachsivvqlplpphidkvaalskikpek
    dadcllpvnvgqlhirernpaivpctasavmellrcsgveicgkrvvvlgrgdiaglpva
    tllanedatvtvvhsatplcdiadivrasdivvsaagqpglvrgewiklgaavidvgttp
    vadpskvpgyrlvgdvcfdvarkraayitpvpggvgpvtvsmllkntltmfkrsvra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cjxB (B:)
    mgsshhhhhhssgenlyfqghmpeavvidgravakaiqkelteevallerrykgrrpgls
    tiicgkrkdsqtyvrlkrkaaaacgfrnfsvelpanvtqealerevirlneeeachsivv
    qlplpphidkvaalskikpekdadcllpvnvgqlhirernpaivpctasavmellrcsgv
    eicgkrvvvlgrgdiaglpvatllanedatvtvvhsatplcdiadivrasdivvsaagqp
    glvrgewiklgaavidvgttpvadpskvpgyrlvgdvcfdvarkraayitpvpggvgpvt
    vsmllkntltmfkrsvral
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cjxB (B:)
    mpeavvidgravakaiqkelteevallerrykgrrpglstiicgkrkdsqtyvrlkrkaa
    aacgfrnfsvelpanvtqealerevirlneeeachsivvqlplpphidkvaalskikpek
    dadcllpvnvgqlhirernpaivpctasavmellrcsgveicgkrvvvlgrgdiaglpva
    tllanedatvtvvhsatplcdiadivrasdivvsaagqpglvrgewiklgaavidvgttp
    vadpskvpgyrlvgdvcfdvarkraayitpvpggvgpvtvsmllkntltmfkrsvra