PDB entry 4cja

View 4cja on RCSB PDB site
Description: BurrH DNA-binding protein from Burkholderia rhizoxinica in complex with its target DNA
Class: transcription
Keywords: transcription, gene targeting, genetics, protein-DNA interaction
Deposited on 2013-12-19, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2063
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: burrh
    Species: Burkholderia rhizoxinica [TaxId:412963]
    Database cross-references and differences (RAF-indexed):
    • PDB 4CJA
    Domains in SCOPe 2.07: d4cjaa_
  • Chain 'B':
    Compound: 5'-d(*dtp*tp*ap*ap*gp*ap*gp*ap*ap*gp*cp*ap*ap*dp *tp*ap*cp*gp*tp*tp*ap*tp*ap)-3'
    Species: BURKHOLDERIA RHIZOXINICA, synthetic [TaxId:412963]
  • Chain 'C':
    Compound: 5'-d(*dtp*ap*tp*ap*ap*cp*gp*tp*ap*tp*tp*tp*gp*cp *tp*tp*cp*tp*cp*tp*tp*ap*ap)-3'
    Species: BURKHOLDERIA RHIZOXINICA, synthetic [TaxId:412963]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cjaA (A:)
    stafvdqdkqmanrlnlsplerskiekqyggattlafisnkqqelaqilsradilkiasy
    dcaahalqavldcgpmlgkrgfsqsdivkiagniggaqalqavldlesmlgkrgfsrddi
    akmagniggaqtlqavldlesafrergfsqadivkiagnnggaqalysvldveptlgkrg
    fsradivkiagntggaqalhtvldlepalgkrgfsridivkiaannggaqalhavldlgp
    tlrecgfsqatiakiagniggaqalqmvldlgpalgkrgfsqatiakiagniggaqalqt
    vldlepalcergfsqatiakmagnnggaqalqtvldlepalrkrdfrqadiikiagndgg
    aqalqaviehgptlrqhgfnladivkmagniggaqalqavldlkpvldehgfsqpdivkm
    agniggaqalqavlslgpalrergfsqpdivkiagntggaqalqavldleltlvehgfsq
    pdivritgnrggaqalqavlaleltlrergfsqpdivkiagnsggaqalqavldleltfr
    ergfsqadivkiagndggtqalhavldlermlgdrgfsradivnvagnnggaqalkavle
    heatlnergfsradivkiagngggaqalkavleheatldergfsradivriagngggaqa
    lkavlehgptlnergfnltdivemaansggaqalkavlehgptlrqrglslidiveiasn
    ggaqalkavlkygpvlmqagrsneeivhvaarrggagrirkmvapllerqggsefelenl
    yfqgelrrqasale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cjaA (A:)
    lnlsplerskiekqyggattlafisnkqqelaqilsradilkiasydcaahalqavldcg
    pmlgkrgfsqsdivkiagniggaqalqavldlesmlgkrgfsrddiakmagniggaqtlq
    avldlesafrergfsqadivkiagnnggaqalysvldveptlgkrgfsradivkiagntg
    gaqalhtvldlepalgkrgfsridivkiaannggaqalhavldlgptlrecgfsqatiak
    iagniggaqalqmvldlgpalgkrgfsqatiakiagniggaqalqtvldlepalcergfs
    qatiakmagnnggaqalqtvldlepalrkrdfrqadiikiagndggaqalqaviehgptl
    rqhgfnladivkmagniggaqalqavldlkpvldehgfsqpdivkmagniggaqalqavl
    slgpalrergfsqpdivkiagntggaqalqavldleltlvehgfsqpdivritgnrggaq
    alqavlaleltlrergfsqpdivkiagnsggaqalqavldleltfrergfsqadivkiag
    ndggtqalhavldlermlgdrgfsradivnvagnnggaqalkavleheatlnergfsrad
    ivkiagngggaqalkavleheatldergfsradivriagngggaqalkavlehgptlner
    gfnltdivemaansggaqalkavlehgptlrqrglslidiveiasnggaqalkavlkygp
    vlmqagrsneeivhvaarrggagrirkmvapll
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.