PDB entry 4cis

View 4cis on RCSB PDB site
Description: Structure of MutM in complex with carbocyclic 8-oxo-G containing DNA
Class: hydrolase
Keywords: hydrolase, base excision repair, DNA repair
Deposited on 2013-12-15, released 2014-06-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.21507
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidin DNA glycosylase
    Species: LACTOCOCCUS LACTIS SUBSP. CREMORIS [TaxId:1359]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q031W6 (Start-271)
      • conflict (53)
      • conflict (123)
      • conflict (193)
      • conflict (267)
    Domains in SCOPe 2.05: d4cisa1, d4cisa2, d4cisa3
  • Chain 'B':
    Compound: formamidopyrimidin DNA glycosylase
    Species: LACTOCOCCUS LACTIS SUBSP. CREMORIS [TaxId:1359]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q031W6 (Start-271)
      • conflict (53)
      • conflict (123)
      • conflict (193)
      • conflict (267)
    Domains in SCOPe 2.05: d4cisb1, d4cisb2, d4cisb3
  • Chain 'C':
    Compound: DNA
    Species:
    Gene:
  • Chain 'D':
    Compound: DNA
    Species:
    Gene:
  • Heterogens: ZN, BU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cisA (A:)
    mpelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyl
    ifeigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelist
    dqvlpyflnkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlw
    lakihpekeanqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvyg
    ktgekcsrcgaeiqkikvagrgthfcpfcqqkgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cisA (A:)
    pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelistd
    qvlpyflnkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpekeanqliessihllhdsiieilqkaiklggssitgkmqnelqvygktgekcsrc
    gaeiqkikvagrgthfcpfcqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cisB (B:)
    mpelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyl
    ifeigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelist
    dqvlpyflnkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlw
    lakihpekeanqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvyg
    ktgekcsrcgaeiqkikvagrgthfcpfcqqkgsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cisB (B:)
    pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgkiiqgiirrgkyli
    feigddfrlishlrmegkyrlatldaprekhdhltmkfsdgqliyadvrkfgtwelistd
    qvlpyflnkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
    akihpekeanqliessihllhdsiieilqkaiklggssirlgstgkmqnelqvygktgek
    csrcgaeiqkikvagrgthfcpfcqqk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.