PDB entry 4cgt

View 4cgt on RCSB PDB site
Description: deletion mutant delta(145-150), f151d of cyclodextrin glycosyltransferase
Class: glycosyltransferase
Keywords: glycosyltransferase, starch degradation, cyclodextrin
Deposited on 1998-06-06, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glycosyltransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30920 (0-677)
      • engineered (144)
    Domains in SCOPe 2.07: d4cgta1, d4cgta2, d4cgta3, d4cgta4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cgtA (A:)
    dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
    indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
    littahakgikividfapnhtspadaengrlydngtlvggytndtngyfhhnggsdfssl
    engiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqkswmssi
    yahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnmyaldsm
    instatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyygteqyl
    tgngdpdnrakmpsfsksttafnvisklaplrksnpaiaygstqqrwinndvyvyerkfg
    ksvavvavnrnlstsasitglstslptgsytdvlggvlngnnitstngsinnftlaagat
    avwqyttaettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedt
    qikvtipsvaagnyavkvaasgvnsnaynnftiltgdqvtvrfvvnnasttlgqnlyltg
    nvaelgnwstgstaigpafnqvihqyptwyydvsvpagkqlefkffkkngstitwesgsn
    htfttpasgtatvtvnwq