PDB entry 4cfz

View 4cfz on RCSB PDB site
Description: savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Class: hydrolase
Keywords: hydrolase, single crystal analysis, powder diffraction, quality control, microcrystalline suspension
Deposited on 2013-11-19, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.14062
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Subtilisin Savinase
  Species: Bacillus lentus [TaxId:1467]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29600 (0-268)
  Domains in SCOPe 2.06: d4cfza_
• Heterogens: CA, NA, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4cfzA (A:)
  aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
  ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
  nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
  asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
  rnhlkntatslgstnlygsglvnaeaatr