PDB entry 4cf6

View 4cf6 on RCSB PDB site
Description: Crystal structure of the complex of the P187S variant of human NAD(P) H:quinone oxidoreductase with Cibacron blue at 2.7 A resolution
Class: oxidoreductase
Keywords: flavoprotein, oxidoreductase, oxidoreductase-inhibitor complex, single amino acid exchange
Deposited on 2013-11-13, released 2014-08-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.1894
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559
      • engineered mutation (206)
    Domains in SCOPe 2.06: d4cf6a_
  • Chain 'B':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (Start-293)
      • engineered mutation (206)
    Domains in SCOPe 2.06: d4cf6b_
  • Heterogens: FAD, CBD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cf6A (A:)
    mgsshhhhhhssglvprgshmvgrralivlahsertsfnyamkeaaaaalkkkgwevves
    dlyamnfnpiisrkditgklkdpanfqypaesvlaykeghlspdivaeqkkleaadlvif
    qfplqwfgvpailkgwfervfigefaytyaamydkgpfrskkavlsittggsgsmyslqg
    ihgdmnvilwpiqsgilhfcgfqvlesqltysightpadariqilegwkkrleniwdetp
    lyfapsslfdlnfqagflmkkevqdeeknkkfglsvghhlgksiptdnqikark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cf6A (A:)
    rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
    anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
    efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
    vlesqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
    qdeeknkkfglsvghhlgksiptdnqikar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cf6B (B:)
    mgsshhhhhhssglvprgshmvgrralivlahsertsfnyamkeaaaaalkkkgwevves
    dlyamnfnpiisrkditgklkdpanfqypaesvlaykeghlspdivaeqkkleaadlvif
    qfplqwfgvpailkgwfervfigefaytyaamydkgpfrskkavlsittggsgsmyslqg
    ihgdmnvilwpiqsgilhfcgfqvlesqltysightpadariqilegwkkrleniwdetp
    lyfapsslfdlnfqagflmkkevqdeeknkkfglsvghhlgksiptdnqikark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cf6B (B:)
    rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
    anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
    efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
    vlesqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
    qdeeknkkfglsvghhlgksiptdnqikark