PDB entry 4ceu

View 4ceu on RCSB PDB site
Description: 1.58 A resolution native Sporosarcina pasteurii urease
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-11-12, released 2014-08-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.13614
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ceua_
  • Chain 'B':
    Compound: urease subunit beta
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ceub_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: SPOROSARCINA PASTEURII [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41020 (0-569)
      • conflict (18)
      • conflict (27)
      • insertion (28)
      • conflict (35-37)
      • conflict (262)
      • conflict (419)
    Domains in SCOPe 2.06: d4ceuc1, d4ceuc2
  • Heterogens: EDO, SO4, NI, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ceuA (A:)
    mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ceuB (B:)
    msnnnyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdra
    egigrrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakel
    gykgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ceuB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ceuC (C:)
    mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
    trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
    viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
    ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
    eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
    tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
    stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
    ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
    gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
    petyevkvdgevltcepvkelpmaqryflf