PDB entry 4cdu

View 4cdu on RCSB PDB site
Description: Crystal structure of human Enterovirus 71 in complex with the uncoating inhibitor GPP3
Class: virus
Keywords: virus, hand-foot-and-mouth disease, enterovirus uncoating, inhibitor
Deposited on 2013-11-06, released 2014-02-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.278
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vp1
  Species: ENTEROVIRUS A71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (0-296)
• Chain 'B':
  Compound: vp2
  Species: ENTEROVIRUS A71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (Start-253)
• Chain 'C':
  Compound: vp3
  Species: ENTEROVIRUS A71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (0-241)
  Domains in SCOPe 2.03: d4cduc_
• Chain 'D':
  Compound: vp4
  Species: ENTEROVIRUS A71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (Start-68)
• Heterogens: YM2, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4cduC (C:)
  gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
  natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
  ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
  ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
  iq
  

  
  
• Chain 'D':
  No sequence available.