PDB entry 4cdd

View 4cdd on RCSB PDB site
Description: Human DPP1 in complex with (2S)-N-((1S)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Class: hydrolase
Keywords: hydrolase, inhibitor
Deposited on 2013-10-31, released 2014-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.18915
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 1 exclusion domain chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cdda_
  • Chain 'B':
    Compound: dipeptidyl peptidase 1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: dipeptidyl peptidase 1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: dipeptidyl peptidase 1 exclusion domain chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cddd_
  • Chain 'E':
    Compound: dipeptidyl peptidase 1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: dipeptidyl peptidase 1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, GDI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cddA (A:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cddA (A:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cddD (D:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cddD (D:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvgt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.