PDB entry 4cdd

View 4cdd on RCSB PDB site
Description: Human DPP1 in complex with (2S)-N-((1S)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Class: hydrolase
Keywords: hydrolase, inhibitor
Deposited on 2013-10-31, released 2014-03-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dipeptidyl peptidase 1 exclusion domain chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (0-End)
  Domains in SCOPe 2.08: d4cdda_
• Chain 'B':
  Compound: dipeptidyl peptidase 1 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (0-End)
• Chain 'C':
  Compound: dipeptidyl peptidase 1 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (Start-68)
• Chain 'D':
  Compound: dipeptidyl peptidase 1 exclusion domain chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (0-119)
  Domains in SCOPe 2.08: d4cddd_
• Chain 'E':
  Compound: dipeptidyl peptidase 1 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634
• Chain 'F':
  Compound: dipeptidyl peptidase 1 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53634 (Start-68)
• Heterogens: NAG, GDI, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4cddA (A:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cddA (A:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4cddD (D:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cddD (D:)
  dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
  tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvgt
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.