PDB entry 4cbo

View 4cbo on RCSB PDB site
Description: Crystal structure of Complement Factor D mutant R202A after ensemble refinement
Class: hydrolase
Keywords: hydrolase, factor d, ensemble refinement
Deposited on 2013-10-15, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • engineered mutation (201)
    Domains in SCOPe 2.07: d4cboa_
  • Chain 'B':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • engineered mutation (201)
    Domains in SCOPe 2.07: d4cbob_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cboA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsavcgnrkkpgiytrvasyaawidsvla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cboB (B:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsavcgnrkkpgiytrvasyaawidsvla