PDB entry 4caa

View 4caa on RCSB PDB site
Description:
Deposited on 1997-08-14, released 1998-02-25
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d4caa.1
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d4caa.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4caaA (A:)
    sanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnltet
    seaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafatdf
    qdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthqsr
    fylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeeveam
    llpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgar
    nlavsqvvhkavldvfeegreasaatavkitll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4caaB (B:)
    rtivrfnrpflmiivptdtqniffmskvtnpkq